Protein Info for Shew_1092 in Shewanella loihica PV-4

Annotation: amino acid carrier protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 85 to 115 (31 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 303 to 326 (24 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 388 to 410 (23 residues), see Phobius details amino acids 417 to 439 (23 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 21 to 442 (422 residues), 485.9 bits, see alignment E=5.3e-150 PF01235: Na_Ala_symp" amino acids 59 to 454 (396 residues), 529.6 bits, see alignment E=6.4e-163 PF03845: Spore_permease" amino acids 65 to 230 (166 residues), 31.5 bits, see alignment E=8.8e-12

Best Hits

Swiss-Prot: 54% identical to GLNT_BACSU: Probable sodium/glutamine symporter GlnT (glnT) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 100% identity to slo:Shew_1092)

Predicted SEED Role

"Na(+)-linked D-alanine glycine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBW5 at UniProt or InterPro

Protein Sequence (492 amino acids)

>Shew_1092 amino acid carrier protein (RefSeq) (Shewanella loihica PV-4)
MFESVLNLVDSTINAVNGMLWGSVLIYVLVAAGVLFTLRLGFIQLRMFGHGSKLVLQGRE
KTNGISSFQVFCTSMAARVGTGNMAGVAVAITVGGAGAVFWMWLIALLGMATAFIESTLA
QVYKVKDSDGQYRGGPAYYMEQGLGKRWMGSLFSVLLIIAFGFAFNAAQANTMTDALNNA
FGLDKTMVGLVIVAVAAYIISGGLKKVAKASELIVPVMAVAYLAIALIVLVMNLEQVPAA
LAYIVKSAFGWEEAAGGAMGAMMAGIARGLFSNEAGMGSAANIAASASPNPNHPASQGFV
QMIGVFVDTIVICSATAAIILLSGVLDAPGEQKGIGLLQLALTNEVGGWAAYFVAFAIIL
FCFSSIIANYSYAESNIMFLSRSKKVLYIFRALVLAMVMAGSVASLQLVWNFADVSMGLM
ALVNIAAIVMLSKVAFAVIKDYEVQLKAGKVPTFDAAHFPELNGLDEKIWKGKPSADALA
KEEGKSIAVPEV