Protein Info for Shew_1089 in Shewanella loihica PV-4

Annotation: transaldolase B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR00874: transaldolase" amino acids 3 to 315 (313 residues), 521 bits, see alignment E=5.9e-161 PF00923: TAL_FSA" amino acids 14 to 311 (298 residues), 331.2 bits, see alignment E=2.8e-103

Best Hits

Swiss-Prot: 100% identical to TAL_SHELP: Transaldolase (tal) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to slo:Shew_1089)

MetaCyc: 72% identical to transaldolase B (Escherichia coli K-12 substr. MG1655)
Transaldolase. [EC: 2.2.1.2]

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBW2 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Shew_1089 transaldolase B (RefSeq) (Shewanella loihica PV-4)
MANTLEQFKSITTIVADTGDIEAIKRYQPQDATTNPSLILKAAQIPEYKHLIANAIEWAK
AQSDDLAQQVEDAGDKLAVNIGLEILKIVPGRISTEVDARLSFDKAGSIEKAHKLIKLYE
EAGIDKSRILIKLASTWEGICAAKELEKEGINCNLTLLFCFAQARACAEAGVYLISPFVG
RILDWYKKDTGLEYSAAEDPGVVSVTNIYNYYKRHGYKTVVMGASFRNTGEIIELAGCDR
LTIGPALLEEMANSDTPVVQKLQAANEVVAPGAALSEAEFRWEFNQDAMAVEKLAEGIRN
FAIDQGKLETMLKAELEA