Protein Info for Shew_1080 in Shewanella loihica PV-4

Annotation: homoserine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 TIGR00191: homoserine kinase" amino acids 3 to 308 (306 residues), 286.7 bits, see alignment E=7.8e-90 PF00288: GHMP_kinases_N" amino acids 65 to 152 (88 residues), 78.5 bits, see alignment E=3.8e-26 PF08544: GHMP_kinases_C" amino acids 217 to 289 (73 residues), 30.4 bits, see alignment E=4.3e-11

Best Hits

Swiss-Prot: 57% identical to KHSE_ECOSM: Homoserine kinase (thrB) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 100% identity to slo:Shew_1080)

MetaCyc: 57% identical to homoserine kinase (Escherichia coli K-12 substr. MG1655)
Homoserine kinase. [EC: 2.7.1.39]; 2.7.1.- [EC: 2.7.1.39]

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBV3 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Shew_1080 homoserine kinase (RefSeq) (Shewanella loihica PV-4)
MSLTVYAPASMGNVGVGFDLLGAALAPVDGCLLGDRVAIESAPHGVSLSLAGHWADKLPA
ASEENIVYQCATFFLEQLGSRAGVAMTLEKNLPVGSGLGSSASSVVAALYALNEHFDRPY
DSDALLRLMGEFEGKISGSVHYDNVAPCYLGGMQLMLDTPSAVCQGLPVFKDWYWVVAYP
GISLSTAKMRALLPAQYDKSVAIDFGRYLSAFVHASYRQDAKLAIEVLKDVLAEPYRASE
IPGYEQARAALDELGMATTGISGSGPTLFSVTDNLETANKAKAWLDANYVTSGSGFSHIC
QIDMLGTRRVDAAILD