Protein Info for Shew_1069 in Shewanella loihica PV-4

Annotation: hydroxylamine reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 transmembrane" amino acids 490 to 508 (19 residues), see Phobius details PF03063: Prismane" amino acids 1 to 547 (547 residues), 548.1 bits, see alignment E=1.1e-168 TIGR01703: hydroxylamine reductase" amino acids 1 to 551 (551 residues), 755 bits, see alignment E=2e-231

Best Hits

Swiss-Prot: 100% identical to HCP_SHELP: Hydroxylamine reductase (hcp) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00378, hydroxylamine reductase [EC: 1.7.-.-] (inferred from 100% identity to slo:Shew_1069)

Predicted SEED Role

"Hydroxylamine reductase (EC 1.7.-.-)" in subsystem Nitrosative stress (EC 1.7.-.-)

Isozymes

Compare fitness of predicted isozymes for: 1.7.-.-

Use Curated BLAST to search for 1.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBU2 at UniProt or InterPro

Protein Sequence (554 amino acids)

>Shew_1069 hydroxylamine reductase (RefSeq) (Shewanella loihica PV-4)
MFCIQCEQTIRTPAGNGCSYSQGMCGKLAATSDLQDLLIYILQGVSAYAEKARAFGIIVP
AIDTFVPKAFFATLTNVNFDDERIMAYTQQAYGYRAQLQAAYESACKAQGQAIETLIPAA
SLVLASVKEEMLALAAQALPNRGKEEVNEDIMGLRLLCLYGLKGAAAYMEHARVLDQTDS
EVAAKFHEIMAFLGSDSVDADKLFATAMEIGQLNYRVMAMLDEGETQAFGHPEPTQVNTV
AVKGKAILVSGHDMKDLELILQQTEGKGINVFTHGEMLPALAYPELKKYPHLVGNYGSAW
QNQQKEFANFPGAVVMTSNCIIDPNVGDYADRIFTRSIVGWPGVTHIVGDDFSAVIDKAL
SLEGFAYDEIPHHITIGFARNALMAAAPAVVENVKNGSIKHFFLVGGCDGDKAERSYFTD
IAKAAPKDSIIMTLGCGKYKFNKLAFGDINGIPRLLDIGQCNDAYSAIQLAIALSEVFEC
EINELPLSLVLSWFEQKAIVILLTLLSLGVKNIRTGPSAPAFLTPNLLKVLEDKFGLRST
TTVEQDLNAILNVA