Protein Info for Shew_1060 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details PF01595: CNNM" amino acids 11 to 180 (170 residues), 179.9 bits, see alignment E=6.2e-57 PF00571: CBS" amino acids 275 to 324 (50 residues), 27.5 bits, see alignment 4.9e-10 PF03471: CorC_HlyC" amino acids 341 to 416 (76 residues), 65.6 bits, see alignment E=4.9e-22

Best Hits

Swiss-Prot: 59% identical to YFJD_ECOLI: UPF0053 inner membrane protein YfjD (yfjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1060)

Predicted SEED Role

"Hemolysins and related proteins containing CBS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBT3 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Shew_1060 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MEAISTSVLVIILFVLIIISAYFSGSETAMMSLNRYRLRHLANNGHKGAKRAIRLLERPD
RLIGLILIGNNLVNILASAIATILGIRLFGDVGVAIATGVLTLVVLVFAEVTPKTVAALH
PERIAFPSSVLLKALLVLLSPLVKIVNFITSTFLRLLGIRSVKADDALSQEELRTVVHEA
GALIPQRHQEMLLSIMDLEKVTVEDIMIPRSDLYAINVNDDFSRINKQVIQSPHTRVLLY
RDNIDDAVGFVHLRDALRLQSKQQFSKSSLLRAVKEIYFIPEGTPLNVQLANFQQNKERI
GLVVDEYGDIQGLVTLEDILEEIVGDFTTSMITTPSEDINQQQDGSFLIDATINIRDLNK
EMDWHFPIDGPKTLNGLILEYLEEIPEPNTSMRLSGYPLEVVEVADNMVKTVRVMPQHYK
APKGSRN