Protein Info for Shew_1058 in Shewanella loihica PV-4

Annotation: holo-acyl-carrier-protein synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR00516: holo-[acyl-carrier-protein] synthase" amino acids 1 to 132 (132 residues), 128.5 bits, see alignment E=1.8e-41 TIGR00556: phosphopantetheine--protein transferase domain" amino acids 1 to 132 (132 residues), 92.7 bits, see alignment E=1.9e-30 PF01648: ACPS" amino acids 4 to 107 (104 residues), 66.2 bits, see alignment E=1.3e-22

Best Hits

Swiss-Prot: 100% identical to ACPS_SHELP: Holo-[acyl-carrier-protein] synthase (acpS) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00997, holo-[acyl-carrier protein] synthase [EC: 2.7.8.7] (inferred from 100% identity to slo:Shew_1058)

MetaCyc: 51% identical to holo-[acyl-carrier-protein] synthase (Escherichia coli K-12 substr. MG1655)
Holo-[acyl-carrier-protein] synthase. [EC: 2.7.8.7]

Predicted SEED Role

"Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBT1 at UniProt or InterPro

Protein Sequence (133 amino acids)

>Shew_1058 holo-acyl-carrier-protein synthase (RefSeq) (Shewanella loihica PV-4)
MIVGLGTDIVEIARIADKVPAAGDEAALAKCPLAKRVLTQAEMAIFVASSQPGRYLAKRF
AAKEAAAKALGTGIGRGVSFQHIEISNDANGAPLIAFQGGAAERLSLLGGSRAHLSIADE
KHYATATVILESN