Protein Info for Shew_1037 in Shewanella loihica PV-4

Annotation: DNA mismatch repair protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR02248: DNA mismatch repair endonuclease MutH" amino acids 8 to 222 (215 residues), 347.6 bits, see alignment E=9.5e-109 PF02976: MutH" amino acids 56 to 154 (99 residues), 121.8 bits, see alignment E=5.2e-40

Best Hits

Swiss-Prot: 72% identical to MUTH_SHESR: DNA mismatch repair protein MutH (mutH) from Shewanella sp. (strain MR-7)

KEGG orthology group: K03573, DNA mismatch repair protein MutH (inferred from 100% identity to slo:Shew_1037)

MetaCyc: 62% identical to DNA mismatch repair protein MutH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair endonuclease MutH" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBR0 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Shew_1037 DNA mismatch repair protein (RefSeq) (Shewanella loihica PV-4)
MKSKILPPESLDELMQRAQEMAGLTLGQLAELHHVAVPSNLKRDKGWIGQLIELELGATA
GSKPEQDFLHLGVELKTIPVDESGKPLETTYVTVAPLMNINGLRWQESLVYHKLQRVLWI
PVEGIRHKPIGERRIGSPILWTPSEEEMAQIRQDWEEIMELIALGKVEQITARHGEVLQL
RPKGANSRALTQSIAQDGQVKLTNPRGFYLKIPFTQQILSRYF