Protein Info for Shew_1015 in Shewanella loihica PV-4

Annotation: Cl- channel, voltage-gated family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 33 to 58 (26 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 170 to 198 (29 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 316 to 338 (23 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 373 to 399 (27 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details PF00654: Voltage_CLC" amino acids 84 to 422 (339 residues), 265 bits, see alignment E=5.3e-83

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1015)

Predicted SEED Role

"Chloride channel protein EriC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBN8 at UniProt or InterPro

Protein Sequence (569 amino acids)

>Shew_1015 Cl- channel, voltage-gated family protein (RefSeq) (Shewanella loihica PV-4)
MQLRINSAIQQCQKYLNTDLKDKLAQAKISVQLCGLALAFALVASGVIILFRLLLLWLNQ
LTQTQEWQFTGNLGDWRVLLPLLGAILIWFVAVLGSKRYKRMGIAYVMQRMKLHYGKIPL
QSAPGQFFQALFALATNFSVGREGPAIHLGAVSASVMAEKFKLPDNSVRIMCASGIAAGI
AATFNAPLAAVIFVFEVILREYKVHYFFPIMLSAICGALSSQLVFGNIHEYDQIGVSHIP
LSQYPVLALCGVTLGCIAALFNHTLLKVTAKGQQHPLILRLLIAGLITTIIGFFLPQALG
SGDLAISHAISEHPSLALLVGLLLGKIIATIAAIGLGIPGGIIGPLFGIGALIGAILAVV
SAMLFPTITPYVGLYTIIGMTAMMGVCLSAPLAALVALLELTNNAAIILPSMFVTIPAFL
IAHQAFNTKSLFYKQIELMGLDYKVSSVKLGLQKQGVRAVMDKRFVIVKDNDELLLEVLK
RAEGRSVLMQNNQGQMEMLQIELQVTEEMSTLTRHPIEGLVDTATLKEVYDILSKERRGE
VFIYQDKRDNVVGVISWVMLQKEINQGQI