Protein Info for Shew_1011 in Shewanella loihica PV-4

Annotation: citrate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 46 (17 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 105 to 135 (31 residues), see Phobius details amino acids 149 to 174 (26 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details PF03600: CitMHS" amino acids 17 to 360 (344 residues), 90.5 bits, see alignment E=5.7e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1011)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBN4 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Shew_1011 citrate transporter (RefSeq) (Shewanella loihica PV-4)
MLNIFLITLAVLALLSIIFEEVTHINKAKTTLFFGCVAWITLFVAARDPSHQHLVAEELD
HNLLEIATLWLFLMSTMTFVAYLNAKGMIQILVQKLFPQKVSVRMLMIQVALFSLVLSAI
CDNVTATLVSLGLLTTFQLESQMKRRMSVLIIFAVNSGGVALITGDVTTLMIFLGGHVHI
SQLLMLFIPAAASVMLLAVLFSLKAEGYVSTTPIKRQYSKLDVFIALIFLITIIMTMVLN
IFFGIPPVLTFLSGLSVMFLMGTLQRSNKEELQILEYIRQVEFETLLFFLGILLLVGMLK
EIGTLHLLTEVYAKFDPNISNFVTGIGSAILDNVPLTAALLKAEPVLNTPEWLGLTYSVG
VGGSLLVIGSAAGIIAMSKVKELTFVTYLKYVPALALCYTCGYGLTLLLAYEFFG