Protein Info for Shew_1009 in Shewanella loihica PV-4

Annotation: peptidoglycan binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 transmembrane" amino acids 275 to 296 (22 residues), see Phobius details PF13191: AAA_16" amino acids 25 to 156 (132 residues), 53.8 bits, see alignment E=1.2e-17 PF13604: AAA_30" amino acids 40 to 190 (151 residues), 29 bits, see alignment E=3.1e-10 PF13401: AAA_22" amino acids 42 to 171 (130 residues), 99.4 bits, see alignment E=7e-32 PF00004: AAA" amino acids 46 to 174 (129 residues), 23.3 bits, see alignment E=2.7e-08 PF09848: SLFN-g3_helicase" amino acids 46 to 206 (161 residues), 27.5 bits, see alignment E=7.1e-10 PF01471: PG_binding_1" amino acids 506 to 559 (54 residues), 37 bits, see alignment 1.1e-12

Best Hits

KEGG orthology group: K02450, general secretion pathway protein A (inferred from 100% identity to slo:Shew_1009)

Predicted SEED Role

"General secretion pathway protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBN2 at UniProt or InterPro

Protein Sequence (587 amino acids)

>Shew_1009 peptidoglycan binding domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MYKAFYGLSDNPFSIAPNPHYLFLSDRHREALAHLTYGLGETGGFVLLTGEVGTGKTTVS
RCLLNQLPENTDTAFILNPSLTELELLATLCDELGVHYGESPTLKQLTDKLSQFLLANHE
KGRNTVLIIDEAQHLRAEVLEQLRLLTNLETDTKKLLQVILIGQPELQQLLKRQELRQLA
QRITARYHLLPLTQQEIALYVQHRLQVAGRHEPLFHRSAIKTLHQYSGGIPRLINLLCER
ALMAGYAQSKVPIDANMVRTAASEVLGEEIKQRKLLWPATAATLILATFAGAFYFFNLQG
HGGIAQANTDQANTAQANMAQTGAVQANEPSATGAQQANQNHSQAVQTQTQPQTQTNLAS
RQVEESNASLSADQRILRQAINQSRSIDTAYAAILGLWDKAPYVGLTACQSAKQQGLDCF
QQQGNWHSLVRLNYPAVVYLQDERGEPFYGTVVSRQGEQLLLQLAEQQLWVDRDWFTRHF
AGTFELLWQAPSYQPKEIGRGSAPAQIQWLENALAQIQNKPARLVDYFDAELEQSLMDFQ
RQHGLRADAIAGSQTLVQLNLYLSDKGPRLQEQQVGLQGRVQGEGRY