Protein Info for Shew_1006 in Shewanella loihica PV-4

Annotation: ErfK/YbiS/YcfS/YnhG family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01476: LysM" amino acids 38 to 81 (44 residues), 27.5 bits, see alignment 3.8e-10 PF03734: YkuD" amino acids 92 to 229 (138 residues), 88.7 bits, see alignment E=8.9e-29 PF17969: Ldt_C" amino acids 234 to 298 (65 residues), 68.9 bits, see alignment E=7.3e-23

Best Hits

Swiss-Prot: 48% identical to YCFS_ECOLI: Probable L,D-transpeptidase YcfS (ycfS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_1006)

MetaCyc: 48% identical to L,D-transpeptidase LdtC (Escherichia coli K-12 substr. MG1655)
RXN0-5401

Predicted SEED Role

"FIG01059907: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBM9 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Shew_1006 ErfK/YbiS/YcfS/YnhG family protein (RefSeq) (Shewanella loihica PV-4)
MMRKLLLLILSLAPLQLLANVYSLPANGGRLIGELQTHVVEKGDYFKTIADKYNIGILEL
METNPGVDPFLPTPGTQLVIPTQMLLPDVPRKGIVINLPELRLYYFPKNGREVHVFPVGI
GRIGRETPEMTTKIKARIPNPSWTPPASLRAEHLRERGEVLPPVVPAGPDNPLGKYAMQL
SYGDGSYLIHGTNKDFGIGMRVSAGCIRLNPDDIEWLFHQAKYGDSVRVINQTVKIATEP
DGRQIIEVHSPLSKTEDQPREKVISLSSKVVKFISQESVDNTKANDALLTQNGIPMVISH
PPLTAAQDLEITP