Protein Info for Shew_1004 in Shewanella loihica PV-4

Annotation: undecaprenyl pyrophosphate phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 151 to 177 (27 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 6 to 257 (252 residues), 248.5 bits, see alignment E=4.2e-78 PF02673: BacA" amino acids 7 to 259 (253 residues), 286.3 bits, see alignment E=1.4e-89

Best Hits

Swiss-Prot: 100% identical to UPPP_SHELP: Undecaprenyl-diphosphatase (uppP) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 100% identity to slo:Shew_1004)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBM7 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Shew_1004 undecaprenyl pyrophosphate phosphatase (RefSeq) (Shewanella loihica PV-4)
MDIFQVIVLALIQGLTEFLPISSSAHLILPAQLLGWQDQGLTFDVAVNTGSLLAVVIYFR
RELFSMFTAWTSSLVTRQQTQESKLAWWIILATIPAVIFGFTAKDFISTHLRNIEVIATT
TIVFGLLLWWADKLNREGFSEFQVGWKKALLIGFAQAMALIPGTSRSGATITAALALGLS
REAAARFSFLMSVPVSLGAAILVVKDLLSSQEAIDYQALVLGTALSFVAAYLCIHYFLKI
ISRMGMTPFVIYRLALGAILCVVIFA