Protein Info for Shew_1001 in Shewanella loihica PV-4

Annotation: putative glycerol-3-phosphate acyltransferase PlsY (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 113 to 136 (24 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 164 to 180 (17 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 4 to 196 (193 residues), 237.4 bits, see alignment E=5.8e-75 PF02660: G3P_acyltransf" amino acids 14 to 186 (173 residues), 182.7 bits, see alignment E=2.9e-58

Best Hits

Swiss-Prot: 100% identical to PLSY_SHELP: Glycerol-3-phosphate acyltransferase (plsY) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 100% identity to slo:Shew_1001)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBM4 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Shew_1001 putative glycerol-3-phosphate acyltransferase PlsY (RefSeq) (Shewanella loihica PV-4)
MSLTLLTLAMILTAYLAGSISSAVLVCRLRGLPDPRSQGSGNPGATNVLRIGGASAAAMV
LLFDMLKGAVPAYVAFRLGVDAVSLGVIAIAACLGHIFPIFFKFKGGKGVATAFGAMAPI
GADLSLALIATWVIVVLICRYSSLAAIVTALLAPAYTWYFDERFTVPVAMLSLLIIIRHK
ENIHRLLKGEESKVSRKKRTDGN