Protein Info for Shew_0988 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 770 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 66 to 88 (23 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 236 to 252 (17 residues), see Phobius details amino acids 538 to 559 (22 residues), see Phobius details amino acids 565 to 590 (26 residues), see Phobius details amino acids 616 to 645 (30 residues), see Phobius details amino acids 656 to 677 (22 residues), see Phobius details TIGR04346: conjugal transfer/type IV secretion protein DotA/TraY" amino acids 32 to 696 (665 residues), 417.2 bits, see alignment E=7.1e-129

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0988)

Predicted SEED Role

"IncI1 plasmid conjugative transfer integral membrane protein TraY" in subsystem Type 4 conjugative transfer system, IncI1 type

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBL1 at UniProt or InterPro

Protein Sequence (770 amino acids)

>Shew_0988 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MRMKTALLLLPLLLSSSLAFASITDVDPQDKSLEYLRYIFGSTVDIITGGTGPSAPDSVL
GAMSQILNTGMLVFTGLIIGYVFLTGVLNSAHEGNPLGKMYSTMWVPLRMVVALALVLPF
SGGYSTMQIGVLWLAGHGIGLANSTWNMALDHISGTGTLYPPQIAINYEQTAMRILESRV
CMHGINTADRHVNIEEKPIEIVADDQVVSMRSSGSTGSTLVPVQHKVMQRYDSRYSLAGA
GVAYGAAWLSGFPSGVPRSYGSNPCGSISLEFAEIDEGTAIDVPVRSFQSKIIQAHADLD
EDLDALAREIVLKAVDDTAPDPDPTAYNMAVQQFKIGYDKAVNDALSEIATARINKWAGG
NPDAAGMTVGARDAGWISVGAWYWDLQRVNAETQKMVSVQAELSGPTESAIENADYKIFS
SALSAYSQNMQVTDPRTGALVNAMERSTYADDNNGLGVVMSTADSILNFALSEPDPIAGM
ANVGHTIITAFETTLAAAFLTDLAACVADDTSEAVGGLIGGASRPVTSTLCRMTNKTLWS
LVGAGFLLIPIALMLAFYLPATPMILWIMGVAGWLVMLIEAVIAAPVWAVSHAMPEGQGF
IGERAKAGYMVALSLFLRPTLAIFGFFSGMLLVIVMGKVLMLLFLPAMSGMIGDSLSGVV
TLAALLAIFTIVLIQIAHRAYGLIHEVPDKVLRYIGGGAENLGEASNEQQSRSIFVGGAA
KLVGGAGHSMRDKTRGGAQSMSEAAGNGIKSATGAAKSGMSKISKMLSPK