Protein Info for Shew_0979 in Shewanella loihica PV-4

Annotation: response regulator receiver modulated diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 816 PF00072: Response_reg" amino acids 13 to 120 (108 residues), 77.6 bits, see alignment E=3e-25 PF08448: PAS_4" amino acids 147 to 250 (104 residues), 28.1 bits, see alignment E=7.2e-10 PF13426: PAS_9" amino acids 167 to 249 (83 residues), 15.5 bits, see alignment E=5.9e-06 amino acids 275 to 381 (107 residues), 26 bits, see alignment E=3.2e-09 TIGR00229: PAS domain S-box protein" amino acids 262 to 382 (121 residues), 36 bits, see alignment E=6.8e-13 PF00989: PAS" amino acids 266 to 378 (113 residues), 40.5 bits, see alignment E=8.5e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 390 to 552 (163 residues), 133.2 bits, see alignment E=7.4e-43 PF00990: GGDEF" amino acids 393 to 550 (158 residues), 160.5 bits, see alignment E=1.1e-50 PF00563: EAL" amino acids 572 to 804 (233 residues), 236 bits, see alignment E=1.4e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0979)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBK2 at UniProt or InterPro

Protein Sequence (816 amino acids)

>Shew_0979 response regulator receiver modulated diguanylate cyclase/phosphodiesterase with PAS/PAC sensor(s) (RefSeq) (Shewanella loihica PV-4)
MLFGNDVETRQKILVVDDESANLHLLEQSLTDLAEIICSTGGQDALDKAEQHQPAIILLD
IEMPQMNGFEMCKRLKNNPKTCNSAVIFVTAHSESSFEYKSLSSGGIDFIHKPIDLATCR
LRVKNHLLLKRQEQTIIEARQDMQALVNQIPSYISYWSKDLLNRFHNDYNGRWFGTIPQD
ALGKPASSLLPKALYEEILARIASNKPKHQFEVALEDTPGKIDYAQAHLTIRKQDGHVAG
MLLTLTDITSIKRAKSQLDTENRRLKIMLNAIGDAVIATDSEAMITFMNPIAERLTGWVC
RDAIGLHIEQVMDLCDAKTKYRSPNPVTIAIKEKRNVAMALNCQLNSLDGTTFQIEDSAA
PITDSEGKVTGGIIVFHDCSESVAMSLKMSHLANHDQLTDLPNRILLHDRINHACAVADS
YDKSVALMLIDIDHFKYLNDSLGHSYGDQVIKQVAKRLQSLIDPNATLGRIGGDEFVLLL
PSLTATSQVDSIATDIVRSLNTPFRIDGQEYTLSVSVGISIYPSDALRAEELMTHVDAAM
YRAKDLGRNRFCYFSEDLEQELTKRHELVTLLRTAIDTEAIEVYYQPKVDLKTKEIIGAE
ALARLYDPSGKLISPLDFIPLAEETGLIHQLGEIILKQSCMAAKAWQKRGRPLQIAVNIA
AKQFTNPEFCDSVAKVLELTGLDSSFLELEVTESSLMYDFDEALNVLNTLSSLGLSIAID
DFGTGYSSLSYLKFFPVNTLKIDQSFVKDMLGDEQSLDIVKAVIHLAKSLKLKLIAEGIE
DAEQLQKLVALECEQGQGYMFSKPLPLKEFDQLLNH