Protein Info for Shew_0966 in Shewanella loihica PV-4

Annotation: beta alanine--pyruvate transaminase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to BAUA_PSEAE: Beta-alanine--pyruvate aminotransferase (bauA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00822, beta-alanine--pyruvate transaminase [EC: 2.6.1.18] (inferred from 100% identity to slo:Shew_0966)

Predicted SEED Role

"Omega-amino acid--pyruvate aminotransferase (EC 2.6.1.18)" in subsystem Pyruvate Alanine Serine Interconversions (EC 2.6.1.18)

MetaCyc Pathways

superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
β-alanine biosynthesis II (5/6 steps found)
β-alanine degradation II (2/2 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBI9 at UniProt or InterPro

Protein Sequence (446 amino acids)

>Shew_0966 beta alanine--pyruvate transaminase (RefSeq) (Shewanella loihica PV-4)
MEDFNKADQVATGTLEHYWMPFTANRQFKQSPRLLAQAEGMYYKDVNGRPVLDGTAGLWC
CNAGHGRKAISEAVSKQIHEMDYAPSFQMGHPLAFELAERLAAIAPKGINKVFFTNSGSE
SVDTALKIALNYHRARGEATRTRFIGRELGYHGVGFGGISVGGIGGNRRTFSQQLLQGVD
HLPHTLDIQQNAFCKGLPETGAEKAEVLEQLVTLHGAENIAAVIVEPMSGSAGVILPPQG
YLKRLREITRKYGILLIFDEVITGFGRVGDAFASQRWGVTPDMITTAKALNNGTIPMGAV
LIDDAIYDASMDAPEGAIELYHGYTYSGHPVAAAAAIATLDIYQEEQLFERTKSLEGYFE
KAVHSLKGLPNLIDIRNTGLVAGIQFSPSDKGIGKRGFGIFETCFKNGTLVRATADTIAL
SPPLIVDEAQIDQMVNTLSDAITTVG