Protein Info for Shew_0953 in Shewanella loihica PV-4

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 350 to 372 (23 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 256 (235 residues), 56.1 bits, see alignment E=3e-19 amino acids 237 to 397 (161 residues), 53.2 bits, see alignment E=2.3e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0953)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBH6 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Shew_0953 major facilitator transporter (RefSeq) (Shewanella loihica PV-4)
MLQNERRRSVDPTFMPRNVWVLTLAQAFAMSATPMMMLLGGLIGAELAPTPALATLPIAI
MVIGVAVSVVPVSRLMRRFGRKKIFLLGSGLGASGGLLAAFATQAQLFVPFCLSGLLLGS
AGAIVQQYRFAAMESVAALDSAKAASRVLVGGLVAAIMGPELAVLGENLFATPHVGAFLF
LICVCLMAGLVLCFYQENRQDKPAHAASHQAVRPLGNILLQPSIWTAIGAATIGYGMMSF
IMTATPLHMHHMEHYSLADTKWVIQSHIIAMYFPSLFSGYLVAKFGTSRMMLVGLAAYGV
TITVALLGRELLNYWVALVLLGVGWNLLFVAGTVLLPRYYHSEERFKVQAFNDAFVFGSQ
ALASLSAGWVLHWLGWEVMLLTCIPLLAIHLLLMAWGRVPLRLANEQKIDET