Protein Info for Shew_0945 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details PF21001: YqiJ_N" amino acids 9 to 114 (106 residues), 79.5 bits, see alignment E=2.3e-26 PF07290: YqiJ_OB" amino acids 143 to 205 (63 residues), 67.5 bits, see alignment E=9e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0945)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBG8 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Shew_0945 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MDFLLLTDNLPYSLALALVILLGLVEGFSMVFGLSLFGLLDDLTPMEMDADVDTGVSGVT
GVAGWLCLDRLPLLIWLVLALTSFAIAGFAINYLAISFHGALPAPLSIPLAIVLGAFSCR
ILGARLANLLPKNETSAVSVDELSGLVGVVTLGCARKGFPSEAVVKDAYQQKHYVLVEPE
LAGEAFSQGTSVVLLNRNGQVWSVVQFNDEI