Protein Info for Shew_0930 in Shewanella loihica PV-4

Annotation: AMMECR1 domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR04335: AmmeMemoRadiSam system protein A" amino acids 16 to 188 (173 residues), 189.4 bits, see alignment E=1.7e-60 PF01871: AMMECR1" amino acids 20 to 188 (169 residues), 135.1 bits, see alignment E=8.6e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0930)

Predicted SEED Role

"COG2078: Uncharacterized ACR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBF3 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Shew_0930 AMMECR1 domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MPASPSIELTASDKACLLDLVWQVIDAGLTQGGLTLPEAPESEALLTPAACFVTLHSSGE
LRGCIGRVDACEPLWLCACENAYGAAFKDRRFAPLRSEERESLTLDISILSPLTPMVNQG
EAALRSSLRPNIDGLLMDDGHHRALFLPSVWQSLPDPKDFVAALKQKGGWPQDYWRDTIT
LQRFTTQVVKD