Protein Info for Shew_0920 in Shewanella loihica PV-4

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 114 to 141 (28 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 356 (18 residues), see Phobius details amino acids 362 to 379 (18 residues), see Phobius details amino acids 399 to 417 (19 residues), see Phobius details amino acids 481 to 503 (23 residues), see Phobius details PF07690: MFS_1" amino acids 63 to 412 (350 residues), 102.2 bits, see alignment E=1.5e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0920)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBE3 at UniProt or InterPro

Protein Sequence (512 amino acids)

>Shew_0920 major facilitator transporter (RefSeq) (Shewanella loihica PV-4)
MSDANDAYADNDLREVKQLGMWASIASLSYIFWIVGGMELVERIAYYGVKASAGLYAKAP
VSQGGLGISLHDYGVIISVWALMQTFIPVFTGGISDRVGYKETIFASTLIKISGYLVMAF
FPNFWGFLFGAILLAGGTGIFKPGIQGTLVLSTGRQNTSMAWGIFYQVVNIGGFLGPLVA
VHMRQLSWDNVFYACAAIISLNFLFLLAYKEPGKEERIERNRKIKSGEITQEALWKDALH
ELKKPVVIYYMLVFAGFWFLFNSLFDVLPIHIAEWVDTSVIVTSLFGSEGTSNGILQFWL
GLDNSGTKVMPEGMLNLNAGMIMTSCFLVAALTAKYRITTAMLAGCLLSIIAFVLIGATN
AAWMIVLAIAMFSFGEMMISPKKNEFMGNIAPKGKKAMYLGFVMLPQGIGWGLEGYFGPK
LYEMYASKEIFSRELLLDRGMSASDIAAIPQGEAFTTLVSYTGESAQSLTTLLYNSHNIG
MAWYIIAAIGTISAVGIFIYGKWLLTLQRARA