Protein Info for Shew_0904 in Shewanella loihica PV-4

Annotation: GPR1/FUN34/yaaH family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 9 to 25 (17 residues), see Phobius details amino acids 28 to 55 (28 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details PF01184: Gpr1_Fun34_YaaH" amino acids 3 to 180 (178 residues), 127.1 bits, see alignment E=3.7e-41

Best Hits

Swiss-Prot: 61% identical to SATP_ECOLI: Succinate-acetate/proton symporter SatP (satP) from Escherichia coli (strain K12)

KEGG orthology group: K07034, (no description) (inferred from 100% identity to slo:Shew_0904)

MetaCyc: 61% identical to acetate/succinate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN0-571

Predicted SEED Role

"Gpr1/fun34/yaaH family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBC7 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Shew_0904 GPR1/FUN34/yaaH family protein (RefSeq) (Shewanella loihica PV-4)
MSTKLANPAPLGLMGFGMTTVLLNIHNAGFFAIDAMILAMGIFYGGLGQVLVGMMCFKRG
DTFGTTAFTSYGLFWLTLVGLIMLPKLGLAAASPSHFMGWYLSLWGLFTAFMFVGSLRYP
RAKQVVFGSLTILFFLLAARDFTGSELIGMIAGFEGIFCGASAIYFAMAQVLNQEYGRVI
LPIGEVKA