Protein Info for Shew_0895 in Shewanella loihica PV-4

Annotation: integral membrane sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 130 to 149 (20 residues), see Phobius details PF00512: HisKA" amino acids 205 to 269 (65 residues), 42 bits, see alignment E=1.6e-14 PF02518: HATPase_c" amino acids 313 to 419 (107 residues), 88.3 bits, see alignment E=9.6e-29 PF14501: HATPase_c_5" amino acids 317 to 410 (94 residues), 27.8 bits, see alignment E=4.3e-10 PF13581: HATPase_c_2" amino acids 321 to 412 (92 residues), 32.2 bits, see alignment E=1.9e-11

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to slo:Shew_0895)

Predicted SEED Role

"Sensory histidine kinase in two-component regulatory system with RstA" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBB8 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Shew_0895 integral membrane sensor signal transduction histidine kinase (RefSeq) (Shewanella loihica PV-4)
MKRLFISLYLLLSLSFLGIGWTLDSIWQNNVDDSGVQDAPLIALAQLIGNLPESQREAFL
AELSTQQSYPLRLLPKAQVAVNLDDSLARDSVLVTAPDEQHELHFIQVDDQQILMAGPIE
IDPREQLRGLFTLFFYLSLALVALIWVWPLSRDLKTLRLATKAFGQAKWDTQIQLSSRSQ
VQPLASTFNEMARHISALIENQKHLSNAVSHEIRTPLARLKFALALVPQYCAPDSDPAQR
QAFLDEMQQDVKEMETLLQELLTYASLESQQQDLEFECCELTRLTQQTISRLQNRHSIPI
YFDEQTPELKVMGDPSLIERALQNLIINAQRFAQSHITIAIRQDNKSVQLEVMDDGPGIA
AVDQEKIFEPFYRSKVVQNGNKGHGLGLAIIKRIMHKHNGRVSLASEPGNTVFTLSWPRV
SANRLRK