Protein Info for Shew_0891 in Shewanella loihica PV-4

Annotation: methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR00229: PAS domain S-box protein" amino acids 25 to 144 (120 residues), 63 bits, see alignment E=1.5e-21 amino acids 146 to 264 (119 residues), 56.5 bits, see alignment E=1.6e-19 PF00989: PAS" amino acids 27 to 134 (108 residues), 29.6 bits, see alignment E=1.8e-10 amino acids 163 to 254 (92 residues), 22.8 bits, see alignment E=2.3e-08 PF08448: PAS_4" amino acids 33 to 139 (107 residues), 49.4 bits, see alignment E=1.4e-16 amino acids 149 to 258 (110 residues), 43.9 bits, see alignment E=7.4e-15 PF13426: PAS_9" amino acids 42 to 137 (96 residues), 47.7 bits, see alignment E=4.9e-16 amino acids 162 to 256 (95 residues), 36.6 bits, see alignment E=1.4e-12 PF08447: PAS_3" amino acids 46 to 131 (86 residues), 53.2 bits, see alignment E=8.8e-18 amino acids 167 to 250 (84 residues), 45.1 bits, see alignment E=3e-15 PF00015: MCPsignal" amino acids 291 to 433 (143 residues), 126.3 bits, see alignment E=3.5e-40

Best Hits

Swiss-Prot: 45% identical to BDLA_PSEAE: Biofilm dispersion protein BdlA (bdlA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to slo:Shew_0891)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QBB4 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Shew_0891 methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq) (Shewanella loihica PV-4)
MFGFNRRKALVPQDEDYQALCDDSQMLRAIRQSAPFIEFTIEGKILSANQQFLSAIGYRL
EEIQGQHHRLLCSPSLASSAAYRTFWQNLAMGEANHGTFQRQHKDGSPIWIEATYVPVAD
DTGRITKVVKIASDVTQEKQQAERQEAIFDALNKSLAYIEFTPQGEIIDANANFCSAMGY
SLEQLKGQHHRLFCTEAFMRQHPDFWADLAKGRFQSGLFERVTRHGQAIWLEATYNPVFD
DAGRVVRVVKLASDITPRIMHQQAVQEASQLAHQSAVETVEITGQGASTLSTATSLANEI
DGAVADATRLMGELAQQSQQISQIVHTIAKVADQTNLLALNAAIEAARAGEQGRGFAVVA
DEVRNLAANTSNATQDIERIVARNSELTQVSEQGMQSIQQKVSLSNQQLAATQALIDEIR
RGAQQVADTVNGLVSKD