Protein Info for Shew_0847 in Shewanella loihica PV-4

Annotation: Rh family protein/ammonium transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 210 to 227 (18 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 275 to 292 (18 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details TIGR03644: probable ammonium transporter, marine subtype" amino acids 16 to 409 (394 residues), 673.1 bits, see alignment E=6.1e-207 PF00909: Ammonium_transp" amino acids 23 to 405 (383 residues), 324.9 bits, see alignment E=3.2e-101

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0847)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB71 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Shew_0847 Rh family protein/ammonium transporter (RefSeq) (Shewanella loihica PV-4)
MEELVTLGATVSELKFALDTFYFLISGALVMWMAAGFAMLEAGLVRSKNTTEILTKNVCL
YSIACIMYLVVGYNIMYVDNAEGGWLPSFASLIGAQASDADHALESDFFFQVVFVATAMS
IVSGAVAERMKLWAFLIFSVVMTGVIYPVEGYWTWGGGFLSEAGFVDFAGSGIVHMAGAA
AAISGVLLLGARKGKYGPNGQVNPIPGSNLPMATLGMFILWMGWFGFNGGSQLLVSDAEN
ASAVAKIFVNTNSAAAFGAVSALVVCKMVWGKADLTMILNGALAGLVAITADPLSPSLPL
AGVIGMVAGGLVVFSIVMFDRVKIDDPVGAISVHGVAGLFGVMLVPLSNADATVLGQLYG
ASVIFAWVFGVSFAAWYILKITMGIRVSEEEEYNGMDASDCGIDAYPEFVSLKSAS