Protein Info for Shew_0842 in Shewanella loihica PV-4

Annotation: two component LuxR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF00072: Response_reg" amino acids 7 to 118 (112 residues), 94.7 bits, see alignment E=8e-31 PF00196: GerE" amino acids 151 to 204 (54 residues), 73.2 bits, see alignment E=2.1e-24 PF13412: HTH_24" amino acids 155 to 192 (38 residues), 24.9 bits, see alignment 2.4e-09

Best Hits

Swiss-Prot: 50% identical to NARP_ECOLI: Nitrate/nitrite response regulator protein NarP (narP) from Escherichia coli (strain K12)

KEGG orthology group: K07685, two-component system, NarL family, nitrate/nitrite response regulator NarP (inferred from 100% identity to slo:Shew_0842)

Predicted SEED Role

"Nitrate/nitrite response regulator protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB66 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Shew_0842 two component LuxR family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MGKPYSVLVVDDHPLLRRGICQLITSDSDFTLFGEAGSGLDALSAIAENEPDIVLLDLNM
KGMTGLDTLNALRQEGVTSRIVILTVSDAKQDVIRLVRAGADGYLLKDTEPDLLLEKLKN
AMQGHRVISESVEDFIYELKDGADEQAWIDNLTPRELQILEQLAEGKSNRVISEQLHISE
GTVKVHVKNLLRKANAKSRTEMAVRYLNQ