Protein Info for Shew_0808 in Shewanella loihica PV-4

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 201 to 222 (22 residues), see Phobius details PF08269: dCache_2" amino acids 35 to 189 (155 residues), 93.4 bits, see alignment E=2.9e-30 PF17200: sCache_2" amino acids 50 to 188 (139 residues), 94.6 bits, see alignment E=1.1e-30 PF00672: HAMP" amino acids 221 to 273 (53 residues), 51.9 bits, see alignment 1.5e-17 PF00015: MCPsignal" amino acids 364 to 520 (157 residues), 142.6 bits, see alignment E=2.3e-45

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to slo:Shew_0808)

Predicted SEED Role

"Methyl-accepting chemotaxis protein, homolog 13"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB32 at UniProt or InterPro

Protein Sequence (554 amino acids)

>Shew_0808 methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella loihica PV-4)
MWQLRMKNKLLVFALLPLILSFLFLVSITYNLESNSLEENMSTFKASLYSERKAQLKDQV
DIALDIVEHQLSLGTAGDVNKALRNVRFGTAGYFFIYDFDGFNRFHAVKPALEGTAQIGM
TDPNGKKIVVGLIDAARSGDGFFNYDYSKPGVTGLVPKIGYAATVPGKDWILGTGAYTDD
IDAQVESYREVMTKHMNDKAMMILLFALVLVAITAVVMLVAAQRMVNPIHNMVQNLEDIA
KGEGDLTKRLDVQGSDEIAMLGRAFNQFVDKLQGIIKDVARATVEVKSGADNISSQTAAM
AQQLISHNNETDQVVTAITEMSATASEVAMSTTQVAEATQAATQDVGNAQECVDSSLHEV
STLMAEIDMAAGHINSLNEQSQKINSVLSVIGGIAEQTNLLALNAAIEAARAGEQGRGFA
VVADEVRSLASRTQASTLEINEMLSELHNLVSLAVSSMESSQQSCHRSVTSSRAISDSLG
AVTSAVTSINDMSTQIATAATEQSSVTEEINRNVFAIQEIVNELLQASNSASDTSQGLAN
EGRNLDTLVGQFKV