Protein Info for Shew_0803 in Shewanella loihica PV-4

Annotation: integral membrane sensor signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 23 to 25 (3 residues), see Phobius details transmembrane" amino acids 7 to 22 (16 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details PF00512: HisKA" amino acids 201 to 259 (59 residues), 43.5 bits, see alignment E=2.7e-15 PF02518: HATPase_c" amino acids 306 to 406 (101 residues), 61.1 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0803)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB27 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Shew_0803 integral membrane sensor signal transduction histidine kinase (RefSeq) (Shewanella loihica PV-4)
MKFQFYRLYALLILSSALIIWSFSEIHGAMQHQVESYQIDVDSVFRGLSEEDSSVLFRQL
SRDELALPQDLADKLDGGETIALTLSGGKTYYYRQAPDISDPNNKEPAKVIAFGPVLRKP
TQAVPTELIIFALYASLGCLALLLIWPLFRDLSQLQASAVEFGANPRKMEQTINKRSAIY
PLAKVFHEVTVQIVDFLQMHKELSRTISHEVRTPLARMRFALQLSKAELDEKYWQRLNAD
IDEIEQLANNYLSFAKLEHREAQIKKEAVSTQAFLDELEEKFALYQDKIGITFIADDRLA
VFDASSMSIATQNLIMNALRFAKQNIQVRFRCEDDLCRITVEDDGPGFEGKGKQLLAAFA
RDKEQSDGSGYGLGLYIARKIAIWHQGRLEVAKSEELGGASLTLVWRNQPAK