Protein Info for Shew_0801 in Shewanella loihica PV-4

Name: rumB
Annotation: 23S rRNA methyluridine methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 TIGR02085: 23S rRNA (uracil-5-)-methyltransferase RumB" amino acids 2 to 376 (375 residues), 580.8 bits, see alignment E=6e-179 PF05958: tRNA_U5-meth_tr" amino acids 208 to 376 (169 residues), 65.3 bits, see alignment E=1e-21 PF05175: MTS" amino acids 233 to 313 (81 residues), 28.3 bits, see alignment E=2.5e-10 PF13847: Methyltransf_31" amino acids 236 to 309 (74 residues), 27.3 bits, see alignment E=5.6e-10

Best Hits

Swiss-Prot: 100% identical to RLMC_SHELP: 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC (rlmC) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03212, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to slo:Shew_0801)

MetaCyc: 56% identical to 23S rRNA m5U747 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11600 [EC: 2.1.1.189]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.189

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB25 at UniProt or InterPro

Protein Sequence (379 amino acids)

>Shew_0801 23S rRNA methyluridine methyltransferase (RefSeq) (Shewanella loihica PV-4)
MKCAYFDANQCLSCRHLKTPLSDQVAAKTATLAALLKDLSVEQWLPPVVGPESGFRNKAK
MVVLGAAHQPILGLVSPSGEAVSLCDCSLYPQDMQQLLHRLEAFVRQAGIPPYRVDKAKG
ELKFILLTRSQVRGEYMLRFVMRSEQAIPRIERELPRLLAEHPEIKVVSVNLQPVHMAIL
EGEEEIFLTEATRLEEEFNGVPLYIRPKSFFQTHPEVAAKLYLSARKWTRELAPTSIWDL
FCGVGGFGLHCASKEVALTGIEIEAEAIACAKMSAETLGLDKVRFTALDSTSFASDSRGE
EKPELIIVNPPRRGIGEALCHSLSEFAPKAILYSSCNPKTLAKDLHCISGYRVTKVQLFD
MFPHTDHFEVLVMLQRIGE