Protein Info for Shew_0797 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 210 to 233 (24 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 379 to 403 (25 residues), see Phobius details amino acids 415 to 433 (19 residues), see Phobius details amino acids 439 to 459 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0797)

Predicted SEED Role

"FIG01058711: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB21 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Shew_0797 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MFRALMFCFLLLSSALPSFAQAEEHTASQNATWHYVDADGQLKIKLYFFWSKTCPHCAEA
HPFIDSLPEKYPWIELESHMVSQAGTQEKWQAIAEQTKVAARSVPYIAACEQATVGYSSE
AVTGQFILQQLKACYRALGGVVADNDQAVQTGMASAEGEPLFATCSASSEPGTCDLGLEE
SAPAAPVTKVQPIELPLIGVVAPEQLSLPVLTVVLAGVDAFNPCAFFVLLFLLSIMVNAK
SRSRMLIVGGIFVFFSGFIYFLFMIAWLNIFELLGAGSDGGLIILGAGLMALVAGAINIK
EYFFTKGEVSLSMSAENRTGLIKRMGKLTSASSMAAMIAGTVVLAILANAYELLCTAGFP
MIYTSVLSMHELPAFERYLYLAFYNIVYVIPLAAIVIAFSATLGKRKLTEKEGQTLKLMS
GIMMIGLGGMLALDPTALQNAGLAIGLIFASIGLTFIISMGRKLIERRGATS