Protein Info for Shew_0793 in Shewanella loihica PV-4

Annotation: FAD-dependent pyridine nucleotide-disulphide oxidoreductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 TIGR03140: alkyl hydroperoxide reductase subunit F" amino acids 1 to 511 (511 residues), 788 bits, see alignment E=1.8e-241 PF13192: Thioredoxin_3" amino acids 123 to 193 (71 residues), 37.1 bits, see alignment E=1.2e-12 PF07992: Pyr_redox_2" amino acids 211 to 498 (288 residues), 162.9 bits, see alignment E=5.4e-51 PF01134: GIDA" amino acids 212 to 251 (40 residues), 21.6 bits, see alignment 4.7e-08 PF13738: Pyr_redox_3" amino acids 260 to 481 (222 residues), 61 bits, see alignment E=5.2e-20 PF00070: Pyr_redox" amino acids 351 to 423 (73 residues), 47.2 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 65% identical to AHPF_PSEPK: Alkyl hydroperoxide reductase subunit F (ahpF) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03387, alkyl hydroperoxide reductase subunit F [EC: 1.6.4.-] (inferred from 100% identity to slo:Shew_0793)

MetaCyc: 57% identical to alkyl hydroperoxide reductase, AhpF component (Escherichia coli K-12 substr. MG1655)
RXN-8506 [EC: 1.5.1.37]; R4-RXN [EC: 1.5.1.37, 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase protein F (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.4.-

Use Curated BLAST to search for 1.11.1.26 or 1.5.1.37 or 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QB17 at UniProt or InterPro

Protein Sequence (521 amino acids)

>Shew_0793 FAD-dependent pyridine nucleotide-disulphide oxidoreductase (RefSeq) (Shewanella loihica PV-4)
MLDANVKNQLTTYLQNLKRPVELVVSADERPKAKELLSLATDIAALSELVSLTESVGERT
PSMTVTSPDTGSQIHFAGLPMGHEFTSLVLALLHTGGHPIKLAPEVIEQIRDLPGEYRFE
TYVSLSCQTCPEVVQALNMMSAINPNIQNTMIDGALFQDEVNERNIMAVPSVYLNGEPFS
VGGISVVEILNKLDVNAASRQAEKLSQKEAFDVLVVGGGPAGASAAIYAARKGLRTGILA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHDYDVDIMDNQRALSLKSGELFEIQ
TESGALLRSKTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADEVLQRKAASMGNIEIITQAMTTEVVGDGTRVQG
LNYTDRATGEQHHVALAGIFVQIGLVPNAEWLKGTVDLSERGEIIVDAKGQTSLPGVFAA
GDVTNSAFKQIIIAMGSGATASLGAFDYLIRLGEPADAEAA