Protein Info for Shew_0772 in Shewanella loihica PV-4

Annotation: single-stranded-DNA-specific exonuclease RecJ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 182 to 197 (16 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 21 to 570 (550 residues), 517.4 bits, see alignment E=1.8e-159 PF01368: DHH" amino acids 71 to 230 (160 residues), 92.5 bits, see alignment E=3.9e-30 PF02272: DHHA1" amino acids 356 to 451 (96 residues), 80.8 bits, see alignment E=1.3e-26 PF17768: RecJ_OB" amino acids 466 to 569 (104 residues), 86.4 bits, see alignment E=2e-28

Best Hits

Swiss-Prot: 58% identical to RECJ_ECOLI: Single-stranded-DNA-specific exonuclease RecJ (recJ) from Escherichia coli (strain K12)

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 100% identity to slo:Shew_0772)

MetaCyc: 58% identical to ssDNA-specific exonuclease RecJ (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.6

Use Curated BLAST to search for 3.1.-.- or 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAZ6 at UniProt or InterPro

Protein Sequence (574 amino acids)

>Shew_0772 single-stranded-DNA-specific exonuclease RecJ (RefSeq) (Shewanella loihica PV-4)
MIHKIVRRPKVDDSHLPSHLSPILKQVYASRGCTVDDCELALANLLRPNTLKDVDKAAAI
IADAMAKQQSILIIGDFDADGATSTSVCLLALRMMGAINVDYLIPNRFDYGYGLSPEIVQ
VAQQKGAELLITVDNGISSIEGVAAAKALGMQVVITDHHLPGNSVPEADAIVNPNQLGCG
FASKAIAGVGVAFYLMSALRAELRSRGWYQAQGIQEPNLATLLDIVALGTVADVVSLDTN
NRILVDAGLKRVRAGRCRPGITALLEVAKRNTSRIVASDFGFAVGPRLNAAGRLDEMALG
VETLLCDDMMRARRMASELDGLNAERRELETGMQQEALKSLESLSLNEAELPWGIALYQQ
DWHQGVIGILASRIKDKYHRPVIAFAEAGEGEIKGSARSIKGLHMRDLLELINARHPGMI
IKFGGHAMAAGLSLRAGEFERFAKAYDEAVRELLAPEQLTGEIVSDGELSPAQLNMALAR
ELRSAGPWGQNFPEPIFDGVFRILQQRIVGERHLKLVLESECGQTMVDAIAFNVDLTTWP
DATIQYAEVAYKLDINEFRGNESLQLMVEQIEPK