Protein Info for Shew_0771 in Shewanella loihica PV-4

Annotation: thiol:disulfide interchange protein DsbC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF10411: DsbC_N" amino acids 30 to 91 (62 residues), 67.4 bits, see alignment E=1.4e-22 PF13098: Thioredoxin_2" amino acids 114 to 237 (124 residues), 90 bits, see alignment E=2.3e-29 PF01323: DSBA" amino acids 184 to 237 (54 residues), 27 bits, see alignment E=7.4e-10

Best Hits

Swiss-Prot: 43% identical to DSBC_PASMU: Thiol:disulfide interchange protein DsbC (dsbC) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K03981, thiol:disulfide interchange protein DsbC [EC: 5.3.4.1] (inferred from 100% identity to slo:Shew_0771)

Predicted SEED Role

"Thiol:disulfide interchange protein DsbC" in subsystem Periplasmic disulfide interchange

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAZ5 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Shew_0771 thiol:disulfide interchange protein DsbC (RefSeq) (Shewanella loihica PV-4)
MKFTRALTLVVAMVATPLMAASNNVVDNGDQLKQKLSDTLGVEVQNLSQSPIPGLYEAIT
NRGVLYISKDGSKLFHGNLYDLDNGMKNLTEAALAGPRMEAIKPFEPNMLVYKAKDEKHV
VTVFTDITCGYCRKLHNQMAEYNDLGITVRYLAFPRQGVPSKNAVDMEAVWCSADPLKAM
TDAKAGKQVSGAKCDAKIAQQYQLGQSLGVNGTPAIILEDGTMIPGYQPPEQLLQVLDRV
Q