Protein Info for Shew_0763 in Shewanella loihica PV-4

Annotation: putative PAS/PAC sensor protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 738 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details PF00989: PAS" amino acids 355 to 453 (99 residues), 28.9 bits, see alignment E=1.5e-10 PF13426: PAS_9" amino acids 358 to 455 (98 residues), 32.1 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0763)

Predicted SEED Role

"sensory box protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAY7 at UniProt or InterPro

Protein Sequence (738 amino acids)

>Shew_0763 putative PAS/PAC sensor protein (RefSeq) (Shewanella loihica PV-4)
MLTQKQPQLIAGQGLHWSAQRIFSVVTQIIILLISVLLLTNVIITLGERRLQEDWATQRY
SELQSVGTLIADKVSFQQFRTQMFANDELLKRYLTIPSEVRQLKLQQSWEVMIRNIPELL
DIALFDPQGKYKFSTTNDFSRDPLPPSLLGGARNMGGNEVYTSPLEFTPIKGKLEPYLYQ
LAWLENPDQSVRGYLLTYQSMSRMLKSIKPAYSSAESPLMMLDTQGLLYAGAESKPTINR
IPDTMGGSLRQTYPALWRKMAMSNFGQFHGDDATFVYLKIELTTQYETRREYYLVSYVRN
DAIAELFSEWRNILIVGAVVLTLLALALILLSHSYRIGQRSREYSIELAHRLFHQDIGCV
IINDKNRVMTANEKAAELLCLPLDELQDRNLQRILQFENEQYAEVAAQLEANNKWQGVID
FDSPGGSHLAITVTSSPRRSRQEKYYLVTFEDVSQLRKVQHQAKLNELLNDNAIPCALVQ
ANGMLELANQAFMQLVSIHDIQGKNLTDLLNNDLSSQWPRITQQILLQGSWKGQILCDPN
SKENTCLQATLKGHLDAAGEIEHIVCTLEQAQKRALLQDTGDFIPHRSAILVNLRDLDDY
FKSLSPVSREHSSLLLIDITAESMLSHMSDIGQLENRQREVEIHILRTLPVNYQMSHWQL
GKLIVILPDTCSDDAHHFAVKSLNGLNEIGLGTGICMGIASYQTGQNLEQYLSNAEVALK
RAKQIGEQNICQAFTRQN