Protein Info for Shew_0739 in Shewanella loihica PV-4

Annotation: aromatic amino acid permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 371 to 389 (19 residues), see Phobius details amino acids 401 to 422 (22 residues), see Phobius details TIGR00814: serine transporter" amino acids 18 to 412 (395 residues), 529.7 bits, see alignment E=2.6e-163 PF03222: Trp_Tyr_perm" amino acids 29 to 390 (362 residues), 50.7 bits, see alignment E=7.7e-18

Best Hits

Swiss-Prot: 44% identical to TDCC_SALNS: Threonine/serine transporter TdcC (tdcC) from Salmonella newport (strain SL254)

KEGG orthology group: K03837, serine transporter (inferred from 100% identity to slo:Shew_0739)

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAW3 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Shew_0739 aromatic amino acid permease (RefSeq) (Shewanella loihica PV-4)
MQNEATISDVNLAQRQGWTRSDTTWMLSLFGTAVGAGILFLPINAGMGGFWPLVLMAVII
GPMTYLAHRGLSRFVCSSQRQGSDITHVVEEYFGVGAGKAITLLYFFAIYPIVLIYGVGI
TNTVDSFIVNQLGMASPPRFLLSGILVLGMMSVMVSGEKFMLKVTQLLVYPLVGILAFMS
LYLIPSWKMDALMEVPAAGEFLGTVWLTIPVLVFAFNHSPAISQFSVSLKKQYGSNAAKK
ADVILRNTSMMLVGFVMLFVFSCVLSLSPAQLAEAKAQNLPILSYLANVHASGFVSYFGP
IIAVIAIVSSFFGHYLGATEGLKGIITKQLRSSNKEVSDAKIDKFILGFMFLTIWGVAVI
NPSILGMIEALGGPIIAAILYLMPMYAVYKVPALKAYRGRISNILVILAGLLAMTAILFG
MLS