Protein Info for Shew_0737 in Shewanella loihica PV-4

Annotation: MarR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01047: MarR
  • amino acids 50 to 106 (57 residues), 32.8 bits, E=2.1e-11
• PF12802: MarR_2
  • amino acids 50 to 106 (57 residues), 38.5 bits, E=4.3e-13
• PF13302: Acetyltransf_3
  • amino acids 166 to 300 (135 residues), 27.2 bits, E=2.4e-09
• PF00583: Acetyltransf_1
  • amino acids 203 to 299 (97 residues), 59.7 bits, E=1.3e-19
• PF13673: Acetyltransf_10
  • amino acids 211 to 318 (108 residues), 28 bits, E=7.5e-10
• PF13508: Acetyltransf_7
  • amino acids 215 to 300 (86 residues), 47.8 bits, E=6.2e-16

Best Hits

KEGG orthology group: K03828, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to slo:Shew_0737)

Predicted SEED Role

"Transcriptional regulator, MarR family / GCN5-related N-acetyltransferase"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See A3QAW1 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Shew_0737 MarR family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MSQSCPSMLDDASLAQAVELPQTCSSLRSLSRQLVRQLGMLNSACGDQPLSPVQAHALIE
LSTQELSIKQLALALNIDKSNASRAVSQLCDKGFAKSRNNPRDSRSSLCQLTAQGKRQLN
SLNEQQNKMYQEILAQLSPEQIAQLEASLRQYTRAMDLASAQQGYTIRSLTQEDNPHIAR
VIRNVSAEYGLTPDKGYSVADPTLDDLYSVYQADKAHYWVVDYKGLVLGGVGIAPLPGHD
DVCELQKMYFDPKLRGKGFAKRMALQAFEFARSQGFSHCYLETTACLSEAVSLYEKLGFE
HLDAPLGNTGHDACEMPMLIKL