Protein Info for Shew_0737 in Shewanella loihica PV-4

Annotation: MarR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF01047: MarR" amino acids 50 to 106 (57 residues), 32.8 bits, see alignment E=2.1e-11 PF12802: MarR_2" amino acids 50 to 106 (57 residues), 38.5 bits, see alignment E=4.3e-13 PF13302: Acetyltransf_3" amino acids 166 to 300 (135 residues), 27.2 bits, see alignment E=2.4e-09 PF00583: Acetyltransf_1" amino acids 203 to 299 (97 residues), 59.7 bits, see alignment E=1.3e-19 PF13673: Acetyltransf_10" amino acids 211 to 318 (108 residues), 28 bits, see alignment E=7.5e-10 PF13508: Acetyltransf_7" amino acids 215 to 300 (86 residues), 47.8 bits, see alignment E=6.2e-16

Best Hits

KEGG orthology group: K03828, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to slo:Shew_0737)

Predicted SEED Role

"Transcriptional regulator, MarR family / GCN5-related N-acetyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAW1 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Shew_0737 MarR family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MSQSCPSMLDDASLAQAVELPQTCSSLRSLSRQLVRQLGMLNSACGDQPLSPVQAHALIE
LSTQELSIKQLALALNIDKSNASRAVSQLCDKGFAKSRNNPRDSRSSLCQLTAQGKRQLN
SLNEQQNKMYQEILAQLSPEQIAQLEASLRQYTRAMDLASAQQGYTIRSLTQEDNPHIAR
VIRNVSAEYGLTPDKGYSVADPTLDDLYSVYQADKAHYWVVDYKGLVLGGVGIAPLPGHD
DVCELQKMYFDPKLRGKGFAKRMALQAFEFARSQGFSHCYLETTACLSEAVSLYEKLGFE
HLDAPLGNTGHDACEMPMLIKL