Protein Info for Shew_0731 in Shewanella loihica PV-4

Annotation: protein of unknown function DUF395, YeeE/YedE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 64 (19 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details PF20398: DUF6691" amino acids 1 to 149 (149 residues), 112.5 bits, see alignment E=1e-36

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 100% identity to slo:Shew_0731)

Predicted SEED Role

"Predicted transporter component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAV5 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Shew_0731 protein of unknown function DUF395, YeeE/YedE (RefSeq) (Shewanella loihica PV-4)
MRNLFALLSGLLFGAGLLLSGLADPAKVLAFLDISGVVNGHWDPSLMLVMGGALGVYLPV
YLLWVKPRMARNQGPVLDSQYHLPSKTRIDGPLIVGAALFGLGWGMLGICPGPAVVNLAS
LDPMALAFMATMVLGAYLGRLINKMIARRLPGPIEA