Protein Info for Shew_0724 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 310 to 333 (24 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details amino acids 401 to 424 (24 residues), see Phobius details PF12704: MacB_PCD" amino acids 20 to 217 (198 residues), 80.2 bits, see alignment E=2.7e-26 PF02687: FtsX" amino acids 314 to 429 (116 residues), 53.4 bits, see alignment E=2.7e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0724)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAU8 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Shew_0724 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MFLYYVDLAWRSIRKTPILSLLMVLAISVGIGITITTLNVYSMMAYNPGGERSEQLNAIQ
LWSQGPDSWDDFHRLVTYQDAMNLRKGNVAKAQAAMFRSGMAVQTDDPEVLPRLQGIRVT
DGDFFKMFEVPFIYGNRWDKAVDLDPAYQAVIGEKLNQKLFGGENSVGKTIYLNRKPYQV
VGVIGDWNPQPKYYDPTSGAFAKSEQIYIPFSLAANEEFSVWGNSSGWKHEPMNNYQDRL
NSEKVWLEYWTYLPTSEDRAAYKSYLANYVEQQKELGRFTDNKSPVDSVLMSDVADWLER
SHVVPEDNKILVGLSALFLSVCLVNILGLMLTKFLKRAPEVGVRRAIGASRAQIFSQYMV
EVGVIGLFGGLVGLLWAWGALYALSARFGVAEGLTHLSMSMWLITPTIAVGTALLAGLYP
AWVVCRTKPSVYLKSQ