Protein Info for Shew_0713 in Shewanella loihica PV-4

Annotation: transport system permease protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 76 to 93 (18 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 256 to 282 (27 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details PF01032: FecCD" amino acids 27 to 341 (315 residues), 291.9 bits, see alignment E=2.6e-91

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to slo:Shew_0713)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAT7 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Shew_0713 transport system permease protein (RefSeq) (Shewanella loihica PV-4)
MTSASLSLGRGYSSLQHLAFVCLGLLTLATPVLAVSFGAAQIGVAEVLEVLLAKLSGADP
GGVTARILIELRLPRILLAFIAGFGLALAGAVLQTVTRNPLADPYLFGISSGASLGAVVV
ITLLGGVGGALASVGLPLGAFIGASLAVLMVLALCGRDLNTQIERMLLSGVAISFLFGAL
ASLMLYFSGPQSAASVLFWSLGSFAKASWQMLWLPWLLVLAASAILLLLKRQILAIQAGD
ETAHTLGIRVQRLRLVSLLLCSLITAVLVANCGGIGFVGLMVPHMVRLLLPGRFALLLTA
LVGGLFMIWVDVLARCLLSYQELPVGIITAVIGSLFFLFILGGKRSN