Protein Info for Shew_0698 in Shewanella loihica PV-4

Annotation: Na+/H+ antiporter NhaC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 12 to 41 (30 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 142 to 171 (30 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 358 to 387 (30 residues), see Phobius details amino acids 397 to 415 (19 residues), see Phobius details amino acids 441 to 459 (19 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 182 to 459 (278 residues), 93.6 bits, see alignment E=6.9e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0698)

Predicted SEED Role

"Na+/H+ antiporter NhaC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAS2 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Shew_0698 Na+/H+ antiporter NhaC (RefSeq) (Shewanella loihica PV-4)
MSDATALSLIPPVVVLVLAVWLRRPILSLIIGALVGLVLYQPDQVLNNFSDISLSVMADE
TIGWLILVCGGFGALIALLVKTGGSMAFGRHALKYAKGPKSSLLMTFILGVVIFIDDYLN
ALTVGSTMKSVTDKFKVSREMLAYVVDSTAAPICVLVPLSTWAVFFGGLLVDNGVAGEGQ
GISVYMSAIPYMLYAWLAVAMVLLVILGIVPAFGPMKKAQLAAMAGKPAKAVDAIDEVQT
SDDYSVKAIEEEFKHADNLGKLHNFMVPIILLVGFTVYFDIDVLKGLIATLAVTLPYYGV
QRLMPLSEMMEQMLDGFKSMLPAIGTVIAAFVFKDVCDKLMLPQYVIGNLSPFMTSQWLP
AVVFLTMSILAFATGSSWGIFAVSIPIVMPLAQAVNADIPLVIGALLSASSFGSQACFYS
DSTVLAAQGSDCNLVSHAVTQLPYALLAAGLTFIGFLILA