Protein Info for Shew_0691 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 20 to 35 (16 residues), see Phobius details amino acids 41 to 59 (19 residues), see Phobius details amino acids 71 to 96 (26 residues), see Phobius details amino acids 158 to 185 (28 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 317 to 345 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 27 to 352 (326 residues), 108.3 bits, see alignment E=2.7e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0691)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAR5 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Shew_0691 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MDNEAKAQQRKEFIGNMTESAIRIGLLAILVIWTYDIVRPFIVPALWGAIIAVALMPLTH
RLERMLKGRRGLAATLIALVGIALLVTPFVVVSGSIFEGVSNTLKVLQSGEIHLPEPTQR
VAEIPIIGERLFEVWHNIASNLEKAILHFLPEIKAGFSALAGVIGSSLATLVMFIISLLI
AAGFMANSEQCAAAMSKVAVRAVGPNAHAWTSLTAATIRSVLLGVVGVAFIQAMLIGSAL
FVFGLPAAGLLTLVALFLGIAQLPALIIVLPLIGYAYSSMEGTSATIFSVWIFLGGISDN
ILKPMLMGRGVDVPMPVILIGAIGGMLFAGIIGLFLGAVVLAIWYELFIAWLNGGEPEAV
LAQAEAPESQRDVEAAE