Protein Info for Shew_0682 in Shewanella loihica PV-4

Annotation: major facilitator superfamily permease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 12 to 45 (34 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 104 to 120 (17 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF11168: DUF2955" amino acids 9 to 147 (139 residues), 46 bits, see alignment E=2.7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0682)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAQ6 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Shew_0682 major facilitator superfamily permease (RefSeq) (Shewanella loihica PV-4)
MFHSPANPIIRLVFGPLALLFYLWSQAAPLAILAPMFMVIFLTLMPSRPPLSLMLKLLLI
VLFVSLGLVFIGGLLLDSPSGYLLFCWSLLFWSFYRSHNDGKDLLATLMLIVVIIMTIMS
KQMQAPIEVLPWLLMKSAVLALILTYLSFLLFPGDEQDILPDETQADGSSAHMGTILFKT
TAMTIVLAALIGIGSSQSMLIAITIGSMIKLADPKEHKSFKQNRLITTAIGILFTFPVML
TFAFGLPTWVVLGMAIFCGLQLAGFAIRRATPLAIYQLLFTNFVVLVYQIITHIGSDALY
AQLVRLISISIAIIIGGLLLSMLHHETGSTDETELTDETGADDEKRSEEAPSNAPAKEPK
AAAQAGN