Protein Info for Shew_0678 in Shewanella loihica PV-4

Annotation: protoporphyrinogen oxidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF12724: Flavodoxin_5" amino acids 5 to 150 (146 residues), 166.9 bits, see alignment E=3.7e-53

Best Hits

KEGG orthology group: K00230, protoporphyrinogen oxidase [EC: 1.3.3.4] (inferred from 100% identity to slo:Shew_0678)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, oxygen-independent, HemG (EC 1.3.-.-)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-, 1.3.3.4

Use Curated BLAST to search for 1.3.-.- or 1.3.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAQ2 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Shew_0678 protoporphyrinogen oxidase (RefSeq) (Shewanella loihica PV-4)
MSKILIIYSSVHGQTRKLCDFMQRELEALEHSVTCASIDNPPAMEGFDKIVLGASIRHGK
HNPRVYDFIRENIKVLQEKASSFFSVSLVARKPAKNTPETNPYMQAFLAKSPWQPKLLAV
FGGNLDYQGYNALDRNIIRFIMWITKGPTAPDTKVEYTDWDKVKHYAQQVDAL