Protein Info for Shew_0674 in Shewanella loihica PV-4

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 113 (18 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 324 to 347 (24 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details PF07690: MFS_1" amino acids 10 to 302 (293 residues), 46.1 bits, see alignment E=1.7e-16 amino acids 205 to 378 (174 residues), 53.8 bits, see alignment E=7.5e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0674)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAP8 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Shew_0674 major facilitator transporter (RefSeq) (Shewanella loihica PV-4)
MLKKNPQTLLLLMTFVMSLVFSVWQVLLNNFVIERASFTGAEIGILQSLREVPGFLAFTA
IFILLLLREQTFALVSLALLTIGVGITGFFPQVLGLYMTTILMSVGFHYYETINQSLTLQ
WVDKADTAGFMGKALAWRSAAALTGYGSIWVVMTYLQLDYQWMYAIIGGLGLLMVIALTL
YFPQFPQGEVQHKKVILRRRYWLYYLLTFFSGARRQIFMVFAGFMMVEKFGYSVSQITAL
FLINYVVNLLFAPAIGRFIGRIGERNALMIEYVGLIVIFTSYAFVQQAEMAAVLYVLDHL
LFAMAIAIKTYFQKIAEPKDIAATMSVSFTINHIAAVVIPALLGMLWLYSNKWVFFIGAG
FALCSLVLAFNIPRHPAQDKHVNWPASA