Protein Info for Shew_0671 in Shewanella loihica PV-4

Annotation: phospholipase A(1) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01058, phospholipase A1 [EC: 3.1.1.32] (inferred from 100% identity to slo:Shew_0671)

Predicted SEED Role

"Phospholipase A1 precursor (EC 3.1.1.32, EC 3.1.1.4); Outer membrane phospholipase A"

MetaCyc Pathways

phosphatidylcholine acyl editing (3/4 steps found)
phospholipases (1/5 steps found)
anandamide biosynthesis I (4/12 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAP5 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Shew_0671 phospholipase A(1) (RefSeq) (Shewanella loihica PV-4)
MQTTQYLKWLPLITLCSLPATCLGAEPTEDKKTTEDSSLLDQRVEDELATSERPFVITPH
KVNYILPVTYNSSPNRDPFDEKLSKNNSEIDNLEAKFQISFKFPLMYNVFGDNGHLFFAY
TNQSYWQVYNKDISSPFRETNHEPEIFMLFNNDWQIGPLTNSFWGVGAVHQSNGNSGSLS
RSWNRIYGTMVFDSGPFALAAKVWWRIPEDEKETPDSPKGDDNPDILDYMGNFELMGVYG
VDQHRFSLMLRNNLESPNRGAVEFTWSYPIIGNLRLYTQYFNGYGESLIDYNAHTQRIGI
GFAINDIL