Protein Info for Shew_0657 in Shewanella loihica PV-4

Annotation: putative nitric oxide reductase (subunit B) transmembrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 233 to 252 (20 residues), see Phobius details amino acids 284 to 308 (25 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details amino acids 446 to 468 (23 residues), see Phobius details amino acids 484 to 506 (23 residues), see Phobius details amino acids 518 to 540 (23 residues), see Phobius details amino acids 548 to 568 (21 residues), see Phobius details amino acids 588 to 611 (24 residues), see Phobius details amino acids 631 to 652 (22 residues), see Phobius details amino acids 670 to 695 (26 residues), see Phobius details amino acids 721 to 742 (22 residues), see Phobius details PF22085: NorB_cytochrome_c-like" amino acids 37 to 219 (183 residues), 218.9 bits, see alignment E=7.1e-69 PF00115: COX1" amino acids 282 to 726 (445 residues), 199.9 bits, see alignment E=7.4e-63

Best Hits

KEGG orthology group: K04561, nitric oxide reductase, cytochrome b-containing subunit I [EC: 1.7.2.5] (inferred from 100% identity to slo:Shew_0657)

MetaCyc: 51% identical to nitric oxide reductase (menaquinol) (Cupriavidus necator H16)
RXN-12129 [EC: 1.7.5.2]

Predicted SEED Role

"Nitric-oxide reductase (EC 1.7.99.7), quinol-dependent" in subsystem Denitrification or Flavohaemoglobin or Nitrosative stress (EC 1.7.99.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.2.5 or 1.7.5.2 or 1.7.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAN1 at UniProt or InterPro

Protein Sequence (763 amino acids)

>Shew_0657 putative nitric oxide reductase (subunit B) transmembrane protein (RefSeq) (Shewanella loihica PV-4)
MNKQRLTAIALLIVLIASFSVLLSIGSQIYREKPPIPTAFTDVQGQPLFTQNDIERGQLV
WRSMGGHQLGSIWGHGSYVAPDWTADWLHREAQAWLDITAKAQYGRSFNELDSIKQAGLE
QSLRDDLRRNTLTTSANGEIRISLSDTRIQAIGQVSDHYLSLFGDDPELSTLREQYAMKE
GTVPDLERRQQLNAFLFWGAWAAITEREGQEYTYTNNWPFDPQLGNTPTSDNIVWSILSI
VTLIAGIGALVWHHASGKHEELPKPAEQDPLFLKKPTASQKAVGKYFVTAVGLFLLQILL
GGVTAHYAVEGQNFYGIPLAEILPYSVTRTWHTQLAVFWIATAWLGTGLYIAPALSGYEP
KFQRLGVNVLWVALVVVVLGSMAGEWIGVQQYFDLDTNFLFGHQGYEYIDLGRVWQVLLL
AGLLIWLTLVTAAMRPALKIQGEMRPVIWVLYASCVAIGLFYGAGLFMGKHTNLAIAEYW
RWWVVHLWVEGFFETFATSVIALMLVRLGLIRARSANGAVLFATVIFLTGGLIGTLHHLY
FTGTPTGVIAWGAIFSALEVVPLALIGFEAIESYRMRNASPWMIRYKWAIMFFVATAFWN
LVGAGVLGFLINPPISLYFIQGLNTTATHGHAAFMGVYGMLGVGLMLFCLRGLTGQIQWS
DKLLKGAFWSLNIGLAAMVFMSLLPVGLTQFFAVIENGYWFARSPEVIHSPLVETLVWMR
VPGDVIFGAGGLFLGAFLFDIIRKAIGAKGTQAIADAPLSANA