Protein Info for Shew_0656 in Shewanella loihica PV-4

Annotation: anaerobic nitric oxide reductase transcription regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 PF01590: GAF" amino acids 22 to 154 (133 residues), 40 bits, see alignment E=1.9e-13 PF00158: Sigma54_activat" amino acids 192 to 358 (167 residues), 234.6 bits, see alignment E=1.9e-73 PF14532: Sigma54_activ_2" amino acids 193 to 363 (171 residues), 66.2 bits, see alignment E=1.4e-21 PF07728: AAA_5" amino acids 215 to 336 (122 residues), 27.2 bits, see alignment E=1.2e-09 PF25601: AAA_lid_14" amino acids 364 to 440 (77 residues), 63.1 bits, see alignment E=6.5e-21

Best Hits

Swiss-Prot: 66% identical to NORR_SERP5: Anaerobic nitric oxide reductase transcription regulator NorR (norR) from Serratia proteamaculans (strain 568)

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 100% identity to slo:Shew_0656)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAN0 at UniProt or InterPro

Protein Sequence (511 amino acids)

>Shew_0656 anaerobic nitric oxide reductase transcription regulator (RefSeq) (Shewanella loihica PV-4)
MALSQTQLTRMALDITSGLSNHDRFSRLLDTIRESMQCDAAALLEFKGQQFTPLAINGLS
PDVLGRRFVLHEHPRLEAIARAGDVVRFPADSDLPDPYDGLIPNQGDNLTVHACIGLPLL
ADGSLIGAVTIDGFDPDQFKSFTNEQLRGISAIASASLNNALLIDKLEKQALQAQWDKGD
STSQSKEGTKEIIGQSQVMNNLKQEIAVVAPTDLNVLIMGETGTGKELIAHEIHQGSMRA
SQPLVYLNCAALPESVAESELFGHVKGAFTGAVSNRSGKFEMADKGSLFLDEIGELPLTL
QAKLLRVLQYGDLQRVGDDRSLKVDVRIIAATNKNLKNEVLAGRFRADLYHRLSVFPLIA
PPLREREQDITLLSGFFVERCRQQLGLQTLRLSPTSLAMLECYQWPGNVRELEHSIYRAA
ILARAQSSGSNGVINPEHFEFANQAPRAVQSSGKTLAPQFSGSLKQATEAFQADYIRQTL
SQHDNNWAATARDLEVDSGNLHRLAKRIGLK