Protein Info for Shew_0644 in Shewanella loihica PV-4

Annotation: FHA domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 PF16697: Yop-YscD_cpl" amino acids 16 to 95 (80 residues), 41.4 bits, see alignment E=3.1e-14 PF00498: FHA" amino acids 25 to 88 (64 residues), 41.9 bits, see alignment E=2.2e-14 PF00437: T2SSE" amino acids 214 to 499 (286 residues), 210.5 bits, see alignment E=6.1e-66 PF27713: UCP018868" amino acids 317 to 424 (108 residues), 39.9 bits, see alignment E=7.7e-14

Best Hits

KEGG orthology group: K02283, pilus assembly protein CpaF (inferred from 100% identity to slo:Shew_0644)

Predicted SEED Role

"Type II/IV secretion system ATP hydrolase TadA/VirB11/CpaF, TadA subfamily" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAL8 at UniProt or InterPro

Protein Sequence (569 amino acids)

>Shew_0644 FHA domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MFNILVSTTKGTKVGEFQCIHRECRVGKDPDQLIVLRGFKISKHHATLRQNEEGIFIVDN
KSRTGVRVNDEKHQEFGPLTLNDKIQVGDYQLRVQSSDPQFQASAPAETPPPPAAPVVAP
AAPVAAAVTSVEAQPPIVTEQSAQIQRRNEWRRKVHTELLKQMDLRRVNVNEMSDTELRA
QSEVLLKQIIDNFKLPDDIEISALTKEVLDETIGLGPLEGLIADPDVTEIMVNSHDQIFY
EKAGNLYLSDIAFSDDQAVLGAIERIVTPIGRRIDESSPMVDARLKDGSRVNAVIPPLAL
KGPCITIRKFMQRRLSCNDLVAFGSMSQAMAEFLEIAVKQKRNVVISGGTGSGKTTLLNV
LSNFIPDNERIVTVEDAAELQLYQPNLVSLEARPPNQEGKGAIEIRDLVKNCLRMRPDRV
VIGECRGGEALDMLQAMNTGHDGSLTTAHSNSPRDCISRLEVMVMMAGMDLPVTAIREQI
TSAVNIIVQQSRFCDGSRRVTSICEVTGIEGTVVQLSEIFKFQQTGFDEQGKVQGYYTAT
GTLPEFYEQLRKQGIAVRLDIFDKDSRYE