Protein Info for Shew_0620 in Shewanella loihica PV-4

Annotation: ion transport 2 domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 190 to 216 (27 residues), see Phobius details PF07885: Ion_trans_2" amino acids 136 to 214 (79 residues), 47.3 bits, see alignment E=1.6e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_0620)

Predicted SEED Role

"cAMP-dependent Kef-type K+ transport system" in subsystem Potassium homeostasis or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAJ4 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Shew_0620 ion transport 2 domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MIDRKRWLLPINQNPTPFELAMMLLSLISVIVVLMLTFAKLDGETRRLLFFIDTSICVIF
ISYFFINLFRAEDKRDYFRHHWIDLVASIPAIEALRLARFFQILRVIRLIRMTRSILIPL
MRQRQETTLASLLVAMVTILTLASVMILLVESGDPNANIHTAENAIWWALVTISTVGYGD
YYPVTTIGHFIGGLVIVCGVSFFGVISGYMASIFIAPDSKQRQEAQSQQMRDELEMVLQR
MEKNQETLLSEIATLKQQLNEKNK