Protein Info for Shew_0614 in Shewanella loihica PV-4

Annotation: cysteine/glutathione ABC transporter membrane/ATP-binding component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 591 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details TIGR02868: thiol reductant ABC exporter, CydC subunit" amino acids 7 to 550 (544 residues), 447.5 bits, see alignment E=3.3e-138 PF00664: ABC_membrane" amino acids 87 to 289 (203 residues), 41.9 bits, see alignment E=1e-14 PF00005: ABC_tran" amino acids 357 to 519 (163 residues), 111.6 bits, see alignment E=4.8e-36

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to slo:Shew_0614)

Predicted SEED Role

"Transport ATP-binding protein CydC" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAI8 at UniProt or InterPro

Protein Sequence (591 amino acids)

>Shew_0614 cysteine/glutathione ABC transporter membrane/ATP-binding component (RefSeq) (Shewanella loihica PV-4)
MKHLLPFIKLFKRQWLMMLVGLLLSLTTLMAGIGLLSLSGWFLSATAVAGLSVVTAQAFN
YFTPAGGVRFLSIARTASRYGERLATHEATFRLLTELRTWAWGKLMPLSAKELSHLRGGD
LLNRLVADIDTLDHLYLRLITPLLASLLMIAALYGFLAWFDSELALTLCGVLLTLWFLLP
LVFYRLGHRPGIAQLESRRQYRVLLLEYLQGQAELTLFGAEKRFRAELDSAQAKLFASQS
TMTAVTALSQALLILSHGLALVLLCYLAADGVGDKVPPGPLLALVVFMTLACIEMLMPLA
GAFQHLSACVQAAERVSEITERRPSIGYGEEASLAASRGALSIAGVSFGYQPGQRVLDDL
SLEVKPGEKLALLGQTGCGKSSLLSLITREWTPDAGTLLLDGRPIEDYSEQALRRAMTVV
SQRIYLFAGTLRDNLTLAQFEQAPEGSRAERKAWREANDAKLIEVLERVGLETLTQGEKP
LDNWIGEGGRQLSGGERRRIGVARALLRDAPLLLLDEPTEGLDQRTEREIMALLLDFAKD
KTMVMISHRLTAMDKMDSIHLMEAGKIRTSGTHQSLLAQDAHYASLNRVLS