Protein Info for Shew_0606 in Shewanella loihica PV-4

Annotation: polysulphide reductase, NrfD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 242 to 245 (4 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details PF03916: NrfD" amino acids 9 to 311 (303 residues), 257.3 bits, see alignment E=1.4e-80

Best Hits

Swiss-Prot: 49% identical to PSRC_WOLSU: Polysulfide reductase chain C (psrC) from Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)

KEGG orthology group: K04015, formate-dependent nitrate reductase complex, transmembrane protein (inferred from 100% identity to slo:Shew_0606)

MetaCyc: 49% identical to polysulfide reductase gamma subunit (Wolinella succinogenes)
RXN-8269 [EC: 1.12.98.4]

Predicted SEED Role

"polysulfide reductase, subunit C" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QAI0 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Shew_0606 polysulphide reductase, NrfD (RefSeq) (Shewanella loihica PV-4)
MNNTWGDMAQYDPVTWNWVIAVYLFMAGLSAGSILIGIGLRWYSKEKAIESAILKAAAII
SPLAITLGLACLVFDLTKPFEFWLILVNYNFSSVMSIGVLALLLYSPIGIAYSLIVLRDE
LTKWKLGFLVPVANAIMPMRKAIEVVLFVLAIGVGAYTGFLISAMNAYPMLNTAVLPALF
LVSGLSAGAAANAIGALLMFNTHSHDANLSKMHGLELPVMLSEIMFLFMLFCALYFKGGA
AAAALASLTTGVWASVFWVGVVGIGFAIPLLTMLMPSQTRHSKGVMIAVACCSLTGVLAL
RHFVIYAGQSYIS